General Information

  • ID:  hor004597
  • Uniprot ID:  P26352
  • Protein name:  Thymosin beta-12
  • Gene name:  NA
  • Organism:  Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
  • Family:  Thymosin beta family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Oncorhynchus (genus), Salmoninae (subfamily), Salmonidae (family), Salmoniformes (order), Protacanthopterygii, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0003779 actin binding; GO:0003785 actin monomer binding
  • GO BP:  GO:0007015 actin filament organization
  • GO CC:  GO:0005737 cytoplasm; GO:0005856 cytoskeleton

Sequence Information

  • Sequence:  SDKPDLAEVSNFDKTKLKKTETQEKNPLPTKETIEQEKQATA
  • Length:  42(2-43)
  • Propeptide:  MSDKPDLAEVSNFDKTKLKKTETQEKNPLPTKETIEQEKQATA
  • Signal peptide:  NA
  • Modification:  T1 N-acetylserine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Plays an important role in the organization of the cytoskeleton.
  • Mechanism:  Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P26352-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor004597_AF2.pdbhor004597_ESM.pdb

Physical Information

Mass: 549177 Formula: C205H341N55O74
Absent amino acids: CGHMRWY Common amino acids: K
pI: 4.96 Basic residues: 8
Polar residues: 10 Hydrophobic residues: 9
Hydrophobicity: -148.81 Boman Index: -13141
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 51.19
Instability Index: 3399.29 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  1575682
  • Title:  The complete sequences of trout (Salmo gairdneri) thymosin beta 11 and its homologue thymosin beta 12.